PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA6G00317
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 283aa    MW: 32710.8 Da    PI: 5.0083
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA6G00317genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+d +   G  +W++ ++  g++R++k+c++rw +yl
        AA6G00317 14 KGPWTVEEDKKLIDFILTNGHCCWRALPKLAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.42.5e-1671111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++l +d++++lG++ W++Ia++++ gRt++++k++w+++
        AA6G00317  71 SQAEEQLVIDLHALLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                      899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-20563IPR009057Homeodomain-like
PROSITE profilePS5129412.982961IPR017930Myb domain
SuperFamilySSF466891.57E-2611108IPR009057Homeodomain-like
SMARTSM007178.0E-121363IPR001005SANT/Myb domain
PfamPF002491.3E-131461IPR001005SANT/Myb domain
CDDcd001675.36E-81661No hitNo description
PROSITE profilePS5129427.35762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2464116IPR009057Homeodomain-like
SMARTSM007177.0E-1566114IPR001005SANT/Myb domain
CDDcd001671.51E-1071112No hitNo description
PfamPF002491.6E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTVE EDKKLIDFIL TNGHCCWRAL PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SQAEEQLVID LHALLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLLKME  120
IDPNTHQPLN KEQNSLENLS KLNKISTEKH RKIVVEIDPK TTNTIEESST ITDQNSSTDD  180
YEFFNDIYKD EDLLNILWTD DEFSLVDASL SNNNNYNVEV VTGDKNNNIV AGEDFPIWTP  240
EEMKGENWML LDYCQDFGVQ DFGFEYYNND IIGQSSIENG QKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002872653.11e-139hypothetical protein ARALYDRAFT_327351
SwissprotQ50EX62e-90ODO1_PETHY; Protein ODORANT1
TrEMBLD7M1061e-139D7M106_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_60025711e-138(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.11e-128myb domain protein 42